PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 262aa    MW: 28865.2 Da    PI: 9.6187
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014578genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.12.4e-181152344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i n+s r+ t+ kR++g++KK +ELS+LCd++++ i++s+ +
  Lus10014578 11 IANDSARKATYKKRKKGLMKKVSELSTLCDIQACAIVYSPYD 52
                 89*************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.31E-25186IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.1149IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-25160IPR002100Transcription factor, MADS-box
CDDcd002667.81E-21286No hitNo description
PRINTSPR004046.3E-10323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-181155IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MTRKKVKLAY IANDSARKAT YKKRKKGLMK KVSELSTLCD IQACAIVYSP YDTQPETWPP  60
TAAGVHQVLS RFRKVPQMEQ CKKMVNQEKF LEERIKKAAE QLRKQKRDND EKMVQNALFE  120
CLTGRISLQS LTLGDLDVIA RAVDQQIKEV DRRLAEIARK GGRGGGGGAG GSAATNGVNN  180
LSLEGSLQMM TPANGGGMVG AAKEEFVENV NHENLQRQLW FMEMMNSNAP APLTAVEQQQ  240
MGFMGGEMMM NNVAADDVVH N*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYIANDSARKATYKKRK
22125KKRKK
3160167GGRGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPOPTR_0005s00420.11e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-53AGAMOUS-like 80